PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10020343
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 310aa    MW: 34668.6 Da    PI: 5.2233
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10020343genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.7e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
      Lus10020343 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLMRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding48.91.5e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E+  +v++ ++lG++ W++Ia++++  Rt++++k++w+++l
      Lus10020343  67 RGNFTPHEERMIVHLQALLGNK-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.3E-24564IPR009057Homeodomain-like
PROSITE profilePS5129425.316965IPR017930Myb domain
SuperFamilySSF466894.87E-3111108IPR009057Homeodomain-like
SMARTSM007172.1E-131363IPR001005SANT/Myb domain
PfamPF002495.2E-161461IPR001005SANT/Myb domain
CDDcd001671.36E-101661No hitNo description
Gene3DG3DSA:1.10.10.604.5E-2565117IPR009057Homeodomain-like
PROSITE profilePS5129419.8866116IPR017930Myb domain
SMARTSM007177.7E-1566114IPR001005SANT/Myb domain
PfamPF002498.0E-1467112IPR001005SANT/Myb domain
CDDcd001679.80E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MGRPPCCDKV GIKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TPHEERMIVH LQALLGNKWA AIASYLPQRT DNDIKNYWNT HLKKKLKNKS  120
TSGTTDHSSS SPPSMSFSTT RVVDVMDHTT PDFIPPTTTT TSTSTNTNTG TSTLPWLAPS  180
TSSISYASST ENISRLLTVW MRKPSEQNLT NNNNVDIGNH DELESILSFE NLNDDMSNNR  240
TKDEDHDDEE IEENGEEMKL ETQTKVAWTS SNLLPPPPPP PLSFLEKWLL DESSGGVQGE  300
ESMEISSIF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-25141164105MYB PROTO-ONCOGENE PROTEIN
1h8a_C3e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465520.11e-109PREDICTED: myb-related protein 306-like
SwissprotP813921e-89MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0D2VHT31e-109A0A0D2VHT3_G
STRINGVIT_08s0056g00800.t011e-105(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82033145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.13e-83myb domain protein 60